"CXCL3" Related Products

Expand
Expand
Expand

Recombinant Human CXCL3 protein

Cat.No. : CXCL3-16H
Product Overview : Recombinant Human CXCL3 protein was expressed in Escherichia coli.
Description : CXCL3, also named GRO-γ, is belonging to the CXC chemokine family and encoded by the gene CXCL3. CXCL3/GRO-γ shares 86 % amino acid sequence with CXCL1/GRO-α. All three human GROs (GRO-α, GRO-β, GRO-γ) are members of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. This chemokine is secreted by monocytes and macrophages. The functional receptor for CXCL3 has been identified as CXCR2. Similar to other GRO proteins, CXCL3 is potent neutrophil attractants and activators. CXCL3 plays a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. All three GROs can bind with high affinity to the IL-8 receptor type B.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Protein length : 73
AA Sequence : ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Endotoxin : Less than 1 EU/µg of rHuGRO-γ/CXCL3 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CXCL3
Official Symbol : CXCL3
Synonyms : CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b;
Gene ID : 2921
mRNA Refseq : NM_002090
Protein Refseq : NP_002081
MIM : 139111
UniProt ID : P19876

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.