"Il3" Related Products

Expand
Expand

Recombinant Mouse Il3 protein

Cat.No. : Il3-09M
Product Overview : Recombinant Mouse Il3 protein was expressed in Escherichia coli.
Description : Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition, it exerts its biological activities through binding to interleukin-3 receptors included α and β subunits. The Mouse IL-3 is different from human IL-3 and contains 140 amino acids residues. Specifically, mouse and human IL-3 share low homology and have not cross species activity.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2 × 107 IU/mg.
Molecular Mass : Approximately 14.8 kDa globular protein containing 134 amino acid residues.
Protein length : 134
AA Sequence : DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Endotoxin : Less than 1 EU/µg of rMuIL-3 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Il3
Official Symbol : Il3
Synonyms : IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu;
Gene ID : 16187
mRNA Refseq : NM_010556
Protein Refseq : NP_034686
UniProt ID : P01586

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.