Recombinant Human DGAT2, GST-tagged

Cat.No. : DGAT2-27398H
Product Overview : Recombinant Human DGAT2 (289 a.a. - 388 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 36.74 kDa
Sequence : IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : DGAT2
Gene Name DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ]
Synonyms DGAT2; diacylglycerol O-acyltransferase 2; ARAT; HMFN1045; GS1999FULL; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; EC 2.3.1.20; EC 2.3.1.76
Gene ID 84649
mRNA Refseq NM_032564
Protein Refseq NP_115953
MIM 606983
UniProt ID Q96PD7
Chromosome Location 11q13.5
Pathway Fat digestion and absorption; Fatty acid, triacylglycerol, and ketone body metabolism; Glycerolipid metabolism
Function 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGAT2 Products

Required fields are marked with *

My Review for All DGAT2 Products

Required fields are marked with *

0
cart-icon