Recombinant Full Length Xenopus Laevis Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged
Cat.No. : | RFL21171XF |
Product Overview : | Recombinant Full Length Xenopus laevis Diacylglycerol O-acyltransferase 2(dgat2) Protein (Q6PAZ3) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MKTIIAAYSGVLRGTGSSLLSAVHDLPSIPWLSKSSVVRHLQIISVLQWVLSFLILGVAC TAVLVYIFCTDLWLIAALYFTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPVKLVKT HNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREY LMSGGICPVNRDTINYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLLHRKGFVKVAL QHGADLVPIYSFGENETYKQVVFEEGSWGRWIQQKFQKYVGFAPCLFHGCSFFSSNSWGL VPYANPITTVVGEPITVPKIEQPTQKDVELYHSMYLSSLHRLFDKYKTKLGLPDSETLEF I |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgat2 |
Synonyms | dgat2; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2 |
UniProt ID | Q6PAZ3 |
◆ Recombinant Proteins | ||
DGAT2-27397H | Recombinant Human DGAT2, GST-tagged | +Inquiry |
RFL10777DF | Recombinant Full Length Dictyostelium Discoideum Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
DGAT2-27398H | Recombinant Human DGAT2, GST-tagged | +Inquiry |
DGAT2-122H | Recombinant Human DGAT2 protein, His-tagged | +Inquiry |
RFL32526MF | Recombinant Full Length Mouse Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All dgat2 Products
Required fields are marked with *
My Review for All dgat2 Products
Required fields are marked with *
0
Inquiry Basket