Recombinant Full Length Dictyostelium Discoideum Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged
| Cat.No. : | RFL10777DF |
| Product Overview : | Recombinant Full Length Dictyostelium discoideum Diacylglycerol O-acyltransferase 2(dgat2) Protein (Q54GC1) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dictyostelium Discoideum |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-330) |
| Form : | Lyophilized powder |
| AA Sequence : | MVRFVPWNVPLYRRLETMAVAIYAMVLPVCLIMAFNLIVIPLFWGIAIPYLVWMFYFDTK HESGGRRVSLVRNSILWRYFRDYFPISLIINSNYDPKKNYIFAYHPHGIISIGAFCNFAT NANNIDEKLPGLKVHLLTLESNFKIPFLRDVLMSFGMSSVSKKSCENILNSGAGESICLV VGGAEESLDARPGLNEITLKKRKGFIKLALVNGASLVPVYSFGENDIYDQVPNPRGSLVR KIQTKIKDLTGIAPPLFMGRGIFNYDFGLLPVRHKIVTVVGEPIDIPKIKSPTDQVIEHY HQIYVEALQNLFDKHKNSCADKETGNLKIN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | dgat2 |
| Synonyms | dgat2; DDB_G0290279; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2 |
| UniProt ID | Q54GC1 |
| ◆ Recombinant Proteins | ||
| RFL21171XF | Recombinant Full Length Xenopus Laevis Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
| DGAT2-27397H | Recombinant Human DGAT2, GST-tagged | +Inquiry |
| DGAT2-27396TH | Recombinant Human DGAT2 protein, GST-tagged | +Inquiry |
| DGAT2-122H | Recombinant Human DGAT2 protein, His-tagged | +Inquiry |
| DGAT2-6906HF | Recombinant Full Length Human DGAT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All dgat2 Products
Required fields are marked with *
My Review for All dgat2 Products
Required fields are marked with *
