Recombinant Human BNIP3 protein, His-tagged
| Cat.No. : | BNIP3-10262H | 
| Product Overview : | Recombinant Human BNIP3 protein(68-121 aa), fused with N-terminal His tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E. coli | 
| Tag : | His | 
| Protein Length : | 68-121 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. | 
| AASequence : | PRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWS | 
| Purity : | 85%, by SDS-PAGE. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| Gene Name | BNIP3 BCL2/adenovirus E1B 19kDa interacting protein 3 [ Homo sapiens ] | 
| Official Symbol | BNIP3 | 
| Synonyms | BNIP3; BCL2/adenovirus E1B 19kDa interacting protein 3; BCL2/adenovirus E1B 19kD interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; Nip3; NIP3; | 
| mRNA Refseq | NM_004052 | 
| Protein Refseq | NP_004043 | 
| MIM | 603293 | 
| UniProt ID | Q12983 | 
| Gene ID | 664 | 
| ◆ Cell & Tissue Lysates | ||
| BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            