Recombinant Human BNIP3 protein, His-tagged
Cat.No. : | BNIP3-10262H |
Product Overview : | Recombinant Human BNIP3 protein(68-121 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 68-121 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | PRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWS |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BNIP3 BCL2/adenovirus E1B 19kDa interacting protein 3 [ Homo sapiens ] |
Official Symbol | BNIP3 |
Synonyms | BNIP3; BCL2/adenovirus E1B 19kDa interacting protein 3; BCL2/adenovirus E1B 19kD interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; Nip3; NIP3; |
mRNA Refseq | NM_004052 |
Protein Refseq | NP_004043 |
MIM | 603293 |
UniProt ID | Q12983 |
Gene ID | 664 |
◆ Recombinant Proteins | ||
RFL18293HF | Recombinant Full Length Human Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry |
BNIP3-1062M | Recombinant Mouse BNIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BNIP3-2403M | Recombinant Mouse BNIP3 Protein (1-156 aa), His-tagged | +Inquiry |
Bnip3-1684R | Recombinant Rat Bnip3 protein, His & GST-tagged | +Inquiry |
BNIP3-2448M | Recombinant Mouse BNIP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *