Recombinant Full Length Human BNIP3 Protein, GST-tagged
| Cat.No. : | BNIP3-3759HF | 
| Product Overview : | Human BNIP3 full-length ORF (NP_004043.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 194 amino acids | 
| Description : | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. This gene contains a BH3 domain and a transmembrane domain, which have been associated with pro-apoptotic function. The dimeric mitochondrial protein encoded by this gene is known to induce apoptosis, even in the presence of BCL2. | 
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 47.74 kDa | 
| AA Sequence : | MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | BNIP3 BCL2/adenovirus E1B 19kDa interacting protein 3 [ Homo sapiens ] | 
| Official Symbol | BNIP3 | 
| Synonyms | BNIP3; BCL2/adenovirus E1B 19kDa interacting protein 3; BCL2/adenovirus E1B 19kD interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; Nip3; NIP3; | 
| Gene ID | 664 | 
| mRNA Refseq | NM_004052 | 
| Protein Refseq | NP_004043 | 
| MIM | 603293 | 
| UniProt ID | Q12983 | 
| ◆ Recombinant Proteins | ||
| BNIP3-3759HF | Recombinant Full Length Human BNIP3 Protein, GST-tagged | +Inquiry | 
| BNIP3-809H | Recombinant Human BNIP3 Protein, His-tagged | +Inquiry | 
| BNIP3-2403M | Recombinant Mouse BNIP3 Protein (1-156 aa), His-tagged | +Inquiry | 
| BNIP3-1062M | Recombinant Mouse BNIP3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RFL18127MF | Recombinant Full Length Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            