Recombinant Human BNIP3 Protein, His-tagged
Cat.No. : | BNIP3-809H |
Product Overview : | Recombinant Human BNIP3 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 20.6kD |
AA Sequence : | MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | BNIP3 BCL2/adenovirus E1B 19kDa interacting protein 3 [ Homo sapiens ] |
Official Symbol | BNIP3 |
Synonyms | BNIP3; BCL2/adenovirus E1B 19kDa interacting protein 3; BCL2/adenovirus E1B 19kD interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; Nip3; NIP3; |
Gene ID | 664 |
mRNA Refseq | NM_004052 |
Protein Refseq | NP_004043 |
MIM | 603293 |
UniProt ID | Q12983 |
◆ Recombinant Proteins | ||
BNIP3-2001Z | Recombinant Zebrafish BNIP3 | +Inquiry |
BNIP3-809H | Recombinant Human BNIP3 Protein, His-tagged | +Inquiry |
Bnip3-1684R | Recombinant Rat Bnip3 protein, His & GST-tagged | +Inquiry |
RFL18293HF | Recombinant Full Length Human Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry |
BNIP3-294H | Recombinant Human BNIP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *