Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation. |
Form : |
Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : |
20.6kD |
AA Sequence : |
MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV |
Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |