Recombinant Human CASP6 protein(59-222 aa), His-tagged
| Cat.No. : | CASP6-10735H |
| Product Overview : | Recombinant Human CASP6 protein(59-222 aa), fused with His tag, was expressed in E. coli. |
| Availability | June 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 59-222 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | CASP6 caspase 6, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP6 |
| Synonyms | CASP6; caspase 6, apoptosis-related cysteine peptidase; caspase 6, apoptosis related cysteine protease; caspase-6; MCH2; apoptotic protease MCH-2; caspase 6, apoptosis-related cysteine protease |
| Gene ID | 839 |
| mRNA Refseq | NM_001226 |
| Protein Refseq | NP_001217 |
| MIM | 601532 |
| UniProt ID | P55212 |
| ◆ Recombinant Proteins | ||
| CASP6-2695Z | Recombinant Zebrafish CASP6 | +Inquiry |
| CASP6-0426H | Active Recombinant Human CASP6 Protein | +Inquiry |
| CASP6-298H | Recombinant Human CASP6 Protein, His-tagged | +Inquiry |
| CASP6-568H | Recombinant Human CASP6 Protein, His-tagged | +Inquiry |
| CASP6-10735H | Recombinant Human CASP6 protein(59-222 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP6-7834HCL | Recombinant Human CASP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
08/08/2024
The CASP6 worked for our application
Ask a Question for All CASP6 Products
Required fields are marked with *
My Review for All CASP6 Products
Required fields are marked with *
