Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CLDN2 protein(184-230 aa), GST-tagged

Cat.No. : CLDN2-11292H
Product Overview : Recombinant Human CLDN2 protein(184-230 aa), fused with N-terminal GST tag, was expressed in E.coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
Source : E.coli
Species : Human
Tag : N-GST
Protein length : 184-230 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AASequence : SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name : CLDN2 claudin 2 [ Homo sapiens ]
Official Symbol : CLDN2
Synonyms : CLDN2; claudin 2; claudin-2; SP82
Gene ID : 9075
mRNA Refseq : NM_001171092
Protein Refseq : NP_001164563
MIM : 300520
UniProt ID : P57739

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Are there ongoing clinical trials related to CLDN2? 01/28/2022

Yes, there are ongoing clinical trials investigating the safety and efficacy of CLDN2-targeted therapies in various disease contexts, including cancer and inflammatory conditions.

Is CLDN2 expression uniform across different types of cancers? 11/13/2020

No, CLDN2 expression varies among different cancer types, and its role may differ depending on the specific context of the disease.

Can CLDN2 levels serve as a prognostic marker in cancer? 09/26/2020

Some studies suggest that elevated CLDN2 levels in certain cancers correlate with a poorer prognosis, making it a potential prognostic marker.

How might CLDN2-targeted therapies benefit patients with inflammatory bowel diseases? 02/10/2019

Modulating CLDN2 expression could help restore epithelial barrier function in the intestines, potentially offering a new avenue for the treatment of inflammatory bowel diseases.

How is CLDN2 expression regulated in normal physiological conditions? 01/08/2019

The regulation of CLDN2 expression involves complex signaling pathways, and understanding these mechanisms is crucial for developing targeted therapies.

Customer Reviews (3)

Write a review
Reviews
05/31/2021

    Its superior binding affinity and specificity enable accurate and reliable detection of target analytes in various biological samples.

    12/15/2018

      Its stability and well-defined structure make it an excellent candidate for visualizing and understanding the three-dimensional arrangement of proteins at a high resolution.

      03/07/2017

        CLDN2 protein has proven to be instrumental in protein electron microscopy structure analysis.

        Ask a Question for All CLDN2 Products

        Required fields are marked with *

        My Review for All CLDN2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends