Recombinant Human CLDN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLDN2-1091H
Product Overview : CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.
Molecular Mass : 24.5 kDa
AA Sequence : MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLDN2 claudin 2 [ Homo sapiens (human) ]
Official Symbol CLDN2
Synonyms CLDN2; claudin 2; claudin-2; SP82
Gene ID 9075
mRNA Refseq NM_020384
Protein Refseq NP_065117
MIM 300520
UniProt ID P57739

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN2 Products

Required fields are marked with *

My Review for All CLDN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon