Recombinant Human CLDN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLDN2-1091H |
Product Overview : | CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene. |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLDN2 claudin 2 [ Homo sapiens (human) ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; SP82 |
Gene ID | 9075 |
mRNA Refseq | NM_020384 |
Protein Refseq | NP_065117 |
MIM | 300520 |
UniProt ID | P57739 |
◆ Recombinant Proteins | ||
CLDN2-26706TH | Recombinant Human CLDN2 | +Inquiry |
RFL29997MF | Recombinant Full Length Mouse Claudin-2(Cldn2) Protein, His-Tagged | +Inquiry |
CLDN2-5001C | Recombinant Chicken CLDN2 | +Inquiry |
Cldn2-900M | Recombinant Mouse Cldn2 Protein, MYC/DDK-tagged | +Inquiry |
CLDN2-06HFL | Recombinant Full Length Human claudin 2 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *