Recombinant Human CLDN2 Protein, GST-tagged
Cat.No. : | CLDN2-1438H |
Product Overview : | Human CLDN2 full-length ORF ( NP_065117.1, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.[provided by RefSeq, Jan 2010] |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN2 claudin 2 [ Homo sapiens ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; SP82; |
Gene ID | 9075 |
mRNA Refseq | NM_001171092 |
Protein Refseq | NP_001164563 |
MIM | 300520 |
UniProt ID | P57739 |
◆ Recombinant Proteins | ||
Cldn2-900M | Recombinant Mouse Cldn2 Protein, MYC/DDK-tagged | +Inquiry |
CLDN2-5001C | Recombinant Chicken CLDN2 | +Inquiry |
RFL21893BF | Recombinant Full Length Bovine Claudin-2(Cldn2) Protein, His-Tagged | +Inquiry |
CLDN2-2052HF | Recombinant Full Length Human CLDN2 Protein, GST-tagged | +Inquiry |
CLDN2-26706TH | Recombinant Human CLDN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *
0
Inquiry Basket