Recombinant Human DSCAM, His-tagged

• Cat.No.: DSCAM-12170H
• Product Overview: Recombinant Human DSCAM Protein is produced by E. coli expression system. The target protein is expressed with sequence Gly1913-Glu2012 of human DSCAM (Accession #NP_001380), fused with a His tag at the N-terminus.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1913-2012 aa
• Form: Lyophilized from sterile PBS, pH7.5, 0.5% SKL, 5% Trehalose, 5% Mannitol.
• Molecular Mass: 15 kDa
• AASequence: MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV
• Endotoxin: Less than 1.0 EU per μg by the LAL method
• Purity: >85% as determined by reduced SDS-PAGE
• Storage: Store it under sterile conditions at -20ºC to -80ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.45mg/ml. Centrifuge the vial at 4ºC before opening to recover the entire contents.

Gene Information

• Gene Name: DSCAM DS cell adhesion molecule [ Homo sapiens ]
• Official Symbol: DSCAM
• Synonyms: CHD2; CHD2-42; CHD2-52
• Gene ID: 1826
• mRNA Refseq: NM_001389
• Protein Refseq: NP_001380
• MIM: 602523
• UniProt ID: O60469