Recombinant Human ETV1 protein, His-tagged
| Cat.No. : | ETV1-12570H |
| Product Overview : | Recombinant Human ETV1 protein(127-477 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 127-477 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | KPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY |
| Gene Name | ETV1 ets variant 1 [ Homo sapiens ] |
| Official Symbol | ETV1 |
| Synonyms | ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81; ets-related protein 81; MGC104699; MGC120533; MGC120534; DKFZp781L0674; |
| Gene ID | 2115 |
| mRNA Refseq | NM_001163147 |
| Protein Refseq | NP_001156619 |
| MIM | 600541 |
| UniProt ID | P50549 |
| ◆ Recombinant Proteins | ||
| ETV1-6479C | Recombinant Chicken ETV1 | +Inquiry |
| ETV1-3531H | Recombinant Human ETV1 Protein, GST-tagged | +Inquiry |
| ETV1-12570H | Recombinant Human ETV1 protein, His-tagged | +Inquiry |
| ETV1-873H | Recombinant Human ETV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ETV1-1275H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV1 Products
Required fields are marked with *
My Review for All ETV1 Products
Required fields are marked with *
