Recombinant Human ETV1 protein, His-tagged
Cat.No. : | ETV1-1276H |
Product Overview : | Recombinant Human ETV1 protein(71-213 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 71-213 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR |
Gene Name | ETV1 ets variant 1 [ Homo sapiens ] |
Official Symbol | ETV1 |
Synonyms | ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81; ets-related protein 81; MGC104699; MGC120533; MGC120534; DKFZp781L0674; |
Gene ID | 2115 |
mRNA Refseq | NM_001163147 |
Protein Refseq | NP_001156619 |
MIM | 600541 |
UniProt ID | P50549 |
◆ Recombinant Proteins | ||
ETV1-4753HF | Recombinant Full Length Human ETV1 Protein, GST-tagged | +Inquiry |
ETV1-3289Z | Recombinant Zebrafish ETV1 | +Inquiry |
ETV1-1277H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
ETV1-1275H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
ETV1-244C | Recombinant Cynomolgus Monkey ETV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV1 Products
Required fields are marked with *
My Review for All ETV1 Products
Required fields are marked with *
0
Inquiry Basket