Recombinant Human FUNDC2 protein, GST-tagged
| Cat.No. : | FUNDC2-13035H |
| Product Overview : | Recombinant Human FUNDC2 protein(1-70 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-70 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FUNDC2 FUN14 domain containing 2 [ Homo sapiens ] |
| Official Symbol | FUNDC2 |
| Synonyms | FUNDC2; FUN14 domain containing 2; FUN14 domain-containing protein 2; DC44; HCBP6; HCC-3; cervical cancer oncogene 3; cervical cancer proto-oncogene 3 protein; hepatitis C virus core-binding protein 6; HCC3; PD03104; MGC2495; FLJ33773; MGC131676; |
| Gene ID | 65991 |
| mRNA Refseq | NM_023934 |
| Protein Refseq | NP_076423 |
| UniProt ID | Q9BWH2 |
| ◆ Recombinant Proteins | ||
| FUNDC2-1587R | Recombinant Rhesus Macaque FUNDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FUNDC2-1766R | Recombinant Rhesus monkey FUNDC2 Protein, His-tagged | +Inquiry |
| FUNDC2-6085M | Recombinant Mouse FUNDC2 Protein | +Inquiry |
| FUNDC2-4550H | Recombinant Human FUNDC2 Protein, GST-tagged | +Inquiry |
| FUNDC2-13035H | Recombinant Human FUNDC2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUNDC2-6120HCL | Recombinant Human FUNDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUNDC2 Products
Required fields are marked with *
My Review for All FUNDC2 Products
Required fields are marked with *
