Recombinant Human GABRA3 protein, GST-tagged
| Cat.No. : | GABRA3-13093H |
| Product Overview : | Recombinant Human GABRA3 protein(24-282 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-282 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLPYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GABRA3 gamma-aminobutyric acid (GABA) A receptor, alpha 3 [ Homo sapiens ] |
| Official Symbol | GABRA3 |
| Synonyms | GABRA3; gamma-aminobutyric acid (GABA) A receptor, alpha 3; gamma-aminobutyric acid receptor subunit alpha-3; GABA(A) receptor; alpha 3; GABA(A) receptor, alpha 3; GABA(A) receptor subunit alpha-3; gamma-animobutyric acid (GABA) A receptor, alpha 3; MGC33793; |
| Gene ID | 2556 |
| mRNA Refseq | NM_000808 |
| Protein Refseq | NP_000799 |
| MIM | 305660 |
| UniProt ID | P34903 |
| ◆ Recombinant Proteins | ||
| GABRA3-13093H | Recombinant Human GABRA3 protein, GST-tagged | +Inquiry |
| GABRA3-5187HF | Recombinant Full Length Human GABRA3 Protein, GST-tagged | +Inquiry |
| GABRA3-2994H | Recombinant Human GABRA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GABRA3-4637H | Recombinant Human GABRA3 Protein, GST-tagged | +Inquiry |
| GABRA3-444H | Recombinant Human GABRA3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GABRA3-6065HCL | Recombinant Human GABRA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRA3 Products
Required fields are marked with *
My Review for All GABRA3 Products
Required fields are marked with *
