Recombinant Human IDH1 protein, His-tagged
| Cat.No. : | IDH1-14047H |
| Product Overview : | Recombinant Human IDH1 protein(341-414 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | September 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 341-414 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | IDH1 isocitrate dehydrogenase 1 (NADP+), soluble [ Homo sapiens ] |
| Official Symbol | IDH1 |
| Synonyms | IDH1; isocitrate dehydrogenase 1 (NADP+), soluble; isocitrate dehydrogenase [NADP] cytoplasmic; NADP(+)-specific ICDH; oxalosuccinate decarboxylase; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; IDH; IDP; IDCD; IDPC; PICD; |
| Gene ID | 3417 |
| mRNA Refseq | NM_005896 |
| Protein Refseq | NP_005887 |
| MIM | 147700 |
| UniProt ID | O75874 |
| ◆ Recombinant Proteins | ||
| IDH1-5849H | Recombinant Human IDH1 protein, DDK-tagged | +Inquiry |
| IDH1-1134H | Recombinant Human IDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Idh1-1583M | Recombinant Mouse Idh1 protein, His & GST-tagged | +Inquiry |
| IDH1-044H | Active Recombinant Human IDH1 Protein, DDK-tagged | +Inquiry |
| IDH1-029H | Recombinant Human IDH1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IDH1-206HKCL | Human IDH1 Knockdown Cell Lysate | +Inquiry |
| IDH1-5307HCL | Recombinant Human IDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDH1 Products
Required fields are marked with *
My Review for All IDH1 Products
Required fields are marked with *
