"ITGA6" Related Products

Expand
Expand
Expand

Recombinant Human ITGA6, GST-tagged

Cat.No.: ITGA6-4111H
Product Overview: Recombinant Human ITGA6 (24 a.a. - 133 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
Description: The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene.
Source: wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.84 kDa
Protein length: 24 a.a. - 133 a.a.
AA Sequence: FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIE FDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
Purification: Glutathione Sepharose 4 Fast Flow
Applications: ELISA; WB; Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ITGA6 integrin, alpha 6 [ Homo sapiens (human) ]
Official Symbol: ITGA6
Synonyms: ITGA6; integrin, alpha 6; CD49f; VLA-6; ITGA6B; integrin alpha-6; integrin alpha6B; CD49 antigen-like family member F
Gene ID: 3655
mRNA Refseq: NM_000210
Protein Refseq: NP_000201
MIM: 147556
UniProt ID: P23229
Chromosome Location: 2q31.1
Pathway: Alpha6-Beta4 Integrin Signaling Pathway; Arf6 trafficking events; Arrhythmogenic right ventricular cardiomyopathy; Assembly of collagen fibrils and other multimeric structures
Function: metal ion binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.