"SRSF5" Related Products

Recombinant Human SFRS5, GST-tagged

Cat.No.: SFRS5-102H
Product Overview: Recombinant Human SFRS5 (1 a.a. - 272 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
Description: The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding the same protein have been found for this gene.
Source: wheat germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 55.44 kDa
Protein length: 1 a.a. - 272 a.a.
AA Sequence: MSGCRVFIGRLNPAAREKGVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARAR SRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVE FASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRS KSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
Purification: Glutathione Sepharose 4 Fast Flow
Applications: ELISA; WB; Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: SRSF5 serine/arginine-rich splicing factor 5 [ Homo sapiens(human) ]
Official Symbol: SRSF5
Synonyms: SRSF5; serine/arginine-rich splicing factor 5; HRS; SFRS5; SRP40; serine/arginine-rich splicing factor 5; SR splicing factor 5; delayed-early protein HRS; pre-mRNA-splicing factor SRP40; splicing factor, arginine/serine-rich 5
Gene ID: 6430
mRNA Refseq: NM_006925
Protein Refseq: NP_008856
MIM: 600914
UniProt ID: Q13243
Chromosome Location: 14q24
Pathway: Cleavage of Growing Transcript in the Termination Region; Gene Expression; Herpes simplex infection
Function: RNA binding; nucleotide binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.