Recombinant Human SFRS5, GST-tagged
Cat.No. : | SFRS5-102H |
Product Overview : | Recombinant Human SFRS5 (1 a.a. - 272 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 272 a.a. |
Description : | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 55.44 kDa |
AA Sequence : | MSGCRVFIGRLNPAAREKGVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARAR SRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVE FASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRS KSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN |
Purification : | Glutathione Sepharose 4 Fast Flow |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SRSF5 serine/arginine-rich splicing factor 5 [ Homo sapiens(human) ] |
Official Symbol | SRSF5 |
Synonyms | SRSF5; serine/arginine-rich splicing factor 5; HRS; SFRS5; SRP40; serine/arginine-rich splicing factor 5; SR splicing factor 5; delayed-early protein HRS; pre-mRNA-splicing factor SRP40; splicing factor, arginine/serine-rich 5 |
Gene ID | 6430 |
mRNA Refseq | NM_006925 |
Protein Refseq | NP_008856 |
MIM | 600914 |
UniProt ID | Q13243 |
Chromosome Location | 14q24 |
Pathway | Cleavage of Growing Transcript in the Termination Region; Gene Expression; Herpes simplex infection |
Function | RNA binding; nucleotide binding; protein binding |
◆ Recombinant Proteins | ||
SRSF5-2861C | Recombinant Chicken SRSF5 | +Inquiry |
SRSF5-468HF | Recombinant Full Length Human SRSF5 Protein, GST-tagged | +Inquiry |
SRSF5-5748R | Recombinant Rat SRSF5 Protein | +Inquiry |
SFRS5-102H | Recombinant Human SFRS5, GST-tagged | +Inquiry |
SRSF5-5407R | Recombinant Rat SRSF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF5-1903HCL | Recombinant Human SFRS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF5 Products
Required fields are marked with *
My Review for All SRSF5 Products
Required fields are marked with *
0
Inquiry Basket