"CYP2C8" Related Products

Expand
Expand

Recombinant Human CYP2C8, GST-tagged

Cat.No.: CYP2C8-120H
Product Overview: Human CYP2C8 full-length ORF ( AAH20596.1, 1 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Several transcript variants encoding a few different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 82.2 kDa
Protein length: 1 a.a. - 490 a.a.
AA Sequence: MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIV VFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDC FPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTK FRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 [Homo sapiens (human) ]
Official Symbol: CYP2C8
Synonyms: CYP2C8; CPC8; CYPIIC8; MP-12/MP-20; cytochrome P450, family 2, subfamily C, polypeptide 8; cytochrome P450 2C8; P450 form 1; cytochrome P450 IIC2; cytochrome P450 MP-12; cytochrome P450 MP-20; cytochrome P450 form 1; microsomal monooxygenase; xenobiotic monooxygenase; s-mephenytoin 4-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8; EC 1.14.14.1
Gene ID: 1558
mRNA Refseq: NM_000770
Protein Refseq: NP_000761
MIM: 601129
UniProt ID: P10632
Chromosome Location: 10q23.33
Pathway: Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations
Function: aromatase activity; caffeine oxidase activity; electron carrier activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.