Expand
| Cat.No.: | CYP2C8-120H |
| Product Overview: | Human CYP2C8 full-length ORF ( AAH20596.1, 1 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Several transcript variants encoding a few different isoforms have been found for this gene. |
| Source: | Wheat germ |
| Species: | Human |
| Tag: | GST |
| Molecular Mass: | 82.2 kDa |
| Protein length: | 1 a.a. - 490 a.a. |
| AA Sequence: | MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIV VFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDC FPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTK FRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
| Storage: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name: | CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 [Homo sapiens (human) ] |
| Official Symbol: | CYP2C8 |
| Synonyms: | CYP2C8; CPC8; CYPIIC8; MP-12/MP-20; cytochrome P450, family 2, subfamily C, polypeptide 8; cytochrome P450 2C8; P450 form 1; cytochrome P450 IIC2; cytochrome P450 MP-12; cytochrome P450 MP-20; cytochrome P450 form 1; microsomal monooxygenase; xenobiotic monooxygenase; s-mephenytoin 4-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8; EC 1.14.14.1 |
| Gene ID: | 1558 |
| mRNA Refseq: | NM_000770 |
| Protein Refseq: | NP_000761 |
| MIM: | 601129 |
| UniProt ID: | P10632 |
| Chromosome Location: | 10q23.33 |
| Pathway: | Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations |
| Function: | aromatase activity; caffeine oxidase activity; electron carrier activity |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All CYP2C8 Products
Download Datasheet