Recombinant Human ADIPOR2, GST-tagged ADIPOR2-210H

Recombinant Human ADIPOR2, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ADIPOR2, GST-tagged

Recombinant Human ADIPOR2, GST-tagged

ADIPOR2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADIPOR2-210H
Product Overview : Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 70.3 kDa
AA Sequence : MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM IGGGCSEEDAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : ADIPOR2 adiponectin receptor 2 [ Homo sapiens (human) ]
Official Symbol : ADIPOR2
Synonyms : ADIPOR2; PAQR2; ACDCR2; adiponectin receptor 2; progestin and adipoQ receptor family member II
Gene ID : 79602
mRNA Refseq : NM_024551
Protein Refseq : NP_078827
MIM : 607946
UniProt ID : Q86V24
Chromosome Location : 12p13.31
Pathway : AMPK signaling; Adipocytokine signaling pathway
Function : hormone binding; identical protein binding; protein heterodimerization activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy