"ADIPOR2" Related Products

Expand
Expand
Expand

Recombinant Human ADIPOR2, GST-tagged

Cat.No.: ADIPOR2-210H
Product Overview: Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 70.3 kDa
AA Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM IGGGCSEEDAL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ADIPOR2 adiponectin receptor 2 [ Homo sapiens (human) ]
Official Symbol: ADIPOR2
Synonyms: ADIPOR2; PAQR2; ACDCR2; adiponectin receptor 2; progestin and adipoQ receptor family member II
Gene ID: 79602
mRNA Refseq: NM_024551
Protein Refseq: NP_078827
MIM: 607946
UniProt ID: Q86V24
Chromosome Location: 12p13.31
Pathway: AMPK signaling; Adipocytokine signaling pathway
Function: hormone binding; identical protein binding; protein heterodimerization activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.