Recombinant Human ADIPOR2, GST-tagged
Cat.No. : | ADIPOR2-210H |
Product Overview : | Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM IGGGCSEEDAL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADIPOR2 adiponectin receptor 2 [ Homo sapiens (human) ] |
Official Symbol | ADIPOR2 |
Synonyms | ADIPOR2; PAQR2; ACDCR2; adiponectin receptor 2; progestin and adipoQ receptor family member II |
Gene ID | 79602 |
mRNA Refseq | NM_024551 |
Protein Refseq | NP_078827 |
MIM | 607946 |
UniProt ID | Q86V24 |
Chromosome Location | 12p13.31 |
Pathway | AMPK signaling; Adipocytokine signaling pathway |
Function | hormone binding; identical protein binding; protein heterodimerization activity |
◆ Recombinant Proteins | ||
ADIPOR2-9427H | Recombinant Human ADIPOR2, GST-tagged | +Inquiry |
ADIPOR2-9430H | Recombinant Human ADIPOR2 protein, GST-tagged | +Inquiry |
ADIPOR2-77R | Recombinant Rhesus Macaque ADIPOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADIPOR2-210H | Recombinant Human ADIPOR2, GST-tagged | +Inquiry |
ADIPOR2-14HF | Recombinant Full Length Human ADIPOR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOR2-9009HCL | Recombinant Human ADIPOR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR2 Products
Required fields are marked with *
My Review for All ADIPOR2 Products
Required fields are marked with *
0
Inquiry Basket