Recombinant Human ADH7, His-tagged

• Cat.No.: ADH7-20H
• Product Overview: Recombinant Human Alcohol Dehydrogenase Class 4 Mu/Sigma Chain/ADH7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Phe386) of Human ADH7 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-386 a.a.
• AA Sequence: MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens ]
• Official Symbol: ADH7
• Synonyms: ADH7; alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide; alcohol dehydrogenase class 4 mu/sigma chain; ADH 4; retinol dehydrogenase; alcohol dehydrogenase-7; alcohol dehydrogenase VII; gastric alcohol dehydrogenase; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; alcohol dehydrogenase class IV mu/sigma chain; ADH4
• Gene ID: 131
• mRNA Refseq: NM_000673
• Protein Refseq: NP_000664
• MIM: 600086
• UniProt ID: P40394
• Chromosome Location: 4q23-q24
• Pathway: Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem
• Function: alcohol dehydrogenase (NAD) activity; alcohol dehydrogenase activity, zinc-dependent; aldehyde oxidase activity; ethanol binding; metal ion binding; nucleotide binding; oxidoreductase activity; receptor antagonist activity; retinol binding; retinol dehydrogenase activity; zinc ion binding