Recombinant Human ATG4A, His-tagged

Cat.No. : ATG4A-36H
Product Overview : Recombinant Human Cysteine Protease ATG4A/ATG4A is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val398) of Human ATG4A fused with a 6His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-398 a.a.
Description : Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers.
Form : Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence : MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKL LSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKE YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDN TVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQS PQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEV TTTGAEFIDSTEQLEEFDLEEDFEILSV
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG4A
Synonyms ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2;
Gene ID 115201
mRNA Refseq NM_052936
Protein Refseq NP_443168
MIM 300663
UniProt ID Q8WYN0
Chromosome Location Xq22.1-q22.3
Pathway Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem;
Function cysteine-type peptidase activity; peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG4A Products

Required fields are marked with *

My Review for All ATG4A Products

Required fields are marked with *

0
cart-icon
0
compare icon