Recombinant Human BCAN, His-tagged BCAN-40H

Recombinant Human BCAN, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BCAN, His-tagged

Recombinant Human BCAN, His-tagged

BCAN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BCAN-40H
Product Overview : Recombinant Human Brevican Core Protein/BCAN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro911) of Human BCAN fused with a polyhistidine tag at the C-terminus.
Description : Brevican Core Protein (BCAN) is a secreted protein that belongs to the aggrecan/versican proteoglycan family. BCAN contains one C-type lectin domain, one EGF-like domain, one Ig-like V-type domain, one Sushi (CCP/SCR) domain and two Link domains. BCAN may play a role in the terminally differentiating and the adult nervous system during postnatal development. BCAN could stabilize interactions between hyaluronan (HA) and brain proteoglycans.
Source : HEK293
Species : Human
Tag : His
AA Sequence : DVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGRE AEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEV KVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPI QTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGA EIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSR FNVYCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIME DGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDE ALWAWPSELSSPGPEASLPTEPAAQEKSLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTET LPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTREL EAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLC LPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINN RYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNY HLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRCQENGRWEAP QISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPGPHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : BCAN brevican [ Homo sapiens ]
Official Symbol : BCAN
Synonyms : BCAN; brevican; brevican core protein; BEHAB; brevican proteoglycan; chondroitin sulfate proteoglycan 7; CSPG7; MGC13038; chondroitin sulfate proteoglycan BEHAB; brain-enriched hyaluronan-binding protein;
Gene ID : 63827
mRNA Refseq : NM_021948
Protein Refseq : NP_068767
UniProt ID : Q96GW7
Chromosome Location : 1q31
Function : binding; hyaluronic acid binding; sugar binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy