"BCAN" Related Products

Expand

Recombinant Human BCAN, His-tagged

Cat.No.: BCAN-40H
Product Overview: Recombinant Human Brevican Core Protein/BCAN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro911) of Human BCAN fused with a polyhistidine tag at the C-terminus.
Description: Brevican Core Protein (BCAN) is a secreted protein that belongs to the aggrecan/versican proteoglycan family. BCAN contains one C-type lectin domain, one EGF-like domain, one Ig-like V-type domain, one Sushi (CCP/SCR) domain and two Link domains. BCAN may play a role in the terminally differentiating and the adult nervous system during postnatal development. BCAN could stabilize interactions between hyaluronan (HA) and brain proteoglycans.
Source: HEK293
Species: Human
Tag: His
AA Sequence: DVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGRE AEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEV KVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPI QTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGA EIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSR FNVYCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIME DGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDE ALWAWPSELSSPGPEASLPTEPAAQEKSLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTET LPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTREL EAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLC LPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINN RYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNY HLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRCQENGRWEAP QISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPGPHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: BCAN brevican [ Homo sapiens ]
Official Symbol: BCAN
Synonyms: BCAN; brevican; brevican core protein; BEHAB; brevican proteoglycan; chondroitin sulfate proteoglycan 7; CSPG7; MGC13038; chondroitin sulfate proteoglycan BEHAB; brain-enriched hyaluronan-binding protein;
Gene ID: 63827
mRNA Refseq: NM_021948
Protein Refseq: NP_068767
UniProt ID: Q96GW7
Chromosome Location: 1q31
Function: binding; hyaluronic acid binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.