Recombinant Human BNIP2, His-tagged

Cat.No. : BNIP2-45H
Product Overview : Recombinant Human BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3/BNIP3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys163) of Human BNIP3 fused with a His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-163 a.a.
Description : BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process.
Form : Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence : MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHES GRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWD WSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name BNIP2 BCL2/adenovirus E1B 19kDa interacting protein 2 [ Homo sapiens ]
Official Symbol BNIP2
Synonyms BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2;
Gene ID 663
mRNA Refseq NM_004330
Protein Refseq NP_004321
MIM 603292
UniProt ID Q12982
Chromosome Location 15q21.3
Pathway CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem;
Function GTPase activator activity; calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BNIP2 Products

Required fields are marked with *

My Review for All BNIP2 Products

Required fields are marked with *

0
cart-icon