Recombinant Human BNIP2, His-tagged
Cat.No. : | BNIP2-45H |
Product Overview : | Recombinant Human BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3/BNIP3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys163) of Human BNIP3 fused with a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-163 a.a. |
Description : | BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process. |
Form : | Supplied as a 0.2 μM filtered solution of PBS, pH 7.4 |
AA Sequence : | MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHES GRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWD WSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | BNIP2 BCL2/adenovirus E1B 19kDa interacting protein 2 [ Homo sapiens ] |
Official Symbol | BNIP2 |
Synonyms | BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2; |
Gene ID | 663 |
mRNA Refseq | NM_004330 |
Protein Refseq | NP_004321 |
MIM | 603292 |
UniProt ID | Q12982 |
Chromosome Location | 15q21.3 |
Pathway | CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
Function | GTPase activator activity; calcium ion binding; protein binding; |
◆ Recombinant Proteins | ||
BNIP2-4995H | Recombinant Human BNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bnip2-717M | Recombinant Mouse Bnip2 Protein, MYC/DDK-tagged | +Inquiry |
BNIP2-45H | Recombinant Human BNIP2, His-tagged | +Inquiry |
BNIP2-11430Z | Recombinant Zebrafish BNIP2 | +Inquiry |
BNIP2-3757HF | Recombinant Full Length Human BNIP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP2-8424HCL | Recombinant Human BNIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP2 Products
Required fields are marked with *
My Review for All BNIP2 Products
Required fields are marked with *