"Myc" Related Products

Expand
Expand
Expand

Recombinant Mouse Myc, Arg-tagged

Cat.No.: Myc-71M
Product Overview: Recombinant Mouse c-Myc-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala439) of Mouse c-Myc fused with a poly-Arginine tag at the C-terminus.
Source: E. coli
Species: Mouse
Tag: Arg
AA Sequence: MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSR RSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNII IQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVV FPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEE EIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRA KLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA PKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: Myc myelocytomatosis oncogene [ Mus musculus ]
Official Symbol: Myc
Synonyms: MYC; myelocytomatosis oncogene; myc proto-oncogene protein; c-myc proto-oncogene; transcription factor p64; Myc2; Nird; Niard; bHLHe39; AU016757;
Gene ID: 17869
mRNA Refseq: NM_001177352
Protein Refseq: NP_001170823
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: DNA binding; DNA binding; E-box binding; double-stranded DNA binding; protein binding; protein complex binding; protein heterodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.