Recombinant Mouse Myc, Arg-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Myc, Arg-tagged

Recombinant Mouse Myc, Arg-tagged

Myc Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Myc-71M
Product Overview : Recombinant Mouse c-Myc-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala439) of Mouse c-Myc fused with a poly-Arginine tag at the C-terminus.
Source : E. coli
Species : Mouse
Tag : Arg
AA Sequence : MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSR RSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNII IQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVV FPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEE EIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRA KLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA PKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : Myc myelocytomatosis oncogene [ Mus musculus ]
Official Symbol : Myc
Synonyms : MYC; myelocytomatosis oncogene; myc proto-oncogene protein; c-myc proto-oncogene; transcription factor p64; Myc2; Nird; Niard; bHLHe39; AU016757;
Gene ID : 17869
mRNA Refseq : NM_001177352
Protein Refseq : NP_001170823
Pathway : Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function : DNA binding; DNA binding; E-box binding; double-stranded DNA binding; protein binding; protein complex binding; protein heterodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.