Recombinant Human CST8, His-tagged

Cat.No. : CST8-76H
Product Overview : Recombinant Human Cystatin-8/CST8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Ala142) of Human CST8 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-142 a.a.
Description : Cystatin-8 is a secreted protein which belongs to the cystatin family. The cystatin superfamily contains multiple cystatin-like sequences. Cystatin-8 localizes to the cystatin locus and encodes a protein similar to type 2 cystatins. Cystatin-8 performs a specialized role during sperm development and maturation. Cystatin-8 exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. In addition, Cystatin-8 performs a specialized role during sperm development and maturation.
AA Sequence : KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLI DVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ]
Official Symbol CST8
Synonyms CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein;
Gene ID 10047
mRNA Refseq NM_005492
Protein Refseq NP_005483
MIM 608683
UniProt ID O60676
Chromosome Location 20p11.21
Function cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST8 Products

Required fields are marked with *

My Review for All CST8 Products

Required fields are marked with *

0
cart-icon
0
compare icon