Recombinant Human CST8, His-tagged
Cat.No. : | CST8-76H |
Product Overview : | Recombinant Human Cystatin-8/CST8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Ala142) of Human CST8 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-142 a.a. |
Description : | Cystatin-8 is a secreted protein which belongs to the cystatin family. The cystatin superfamily contains multiple cystatin-like sequences. Cystatin-8 localizes to the cystatin locus and encodes a protein similar to type 2 cystatins. Cystatin-8 performs a specialized role during sperm development and maturation. Cystatin-8 exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. In addition, Cystatin-8 performs a specialized role during sperm development and maturation. |
AA Sequence : | KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLI DVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ] |
Official Symbol | CST8 |
Synonyms | CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein; |
Gene ID | 10047 |
mRNA Refseq | NM_005492 |
Protein Refseq | NP_005483 |
MIM | 608683 |
UniProt ID | O60676 |
Chromosome Location | 20p11.21 |
Function | cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity; |
◆ Recombinant Proteins | ||
CST8-76H | Recombinant Human CST8, His-tagged | +Inquiry |
Cst8-5417M | Recombinant Mouse Cst8 Protein (Met1-Pro98), N-His tagged | +Inquiry |
CST8-2241HF | Recombinant Full Length Human CST8 Protein, GST-tagged | +Inquiry |
CST8-667H | Recombinant Human CST8 Protein, Fc-tagged | +Inquiry |
CST8-2033H | Recombinant Human CST8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST8-7226HCL | Recombinant Human CST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST8 Products
Required fields are marked with *
My Review for All CST8 Products
Required fields are marked with *