"CST8" Related Products

Expand

Recombinant Human CST8, His-tagged

Cat.No.: CST8-76H
Product Overview: Recombinant Human Cystatin-8/CST8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Ala142) of Human CST8 fused with a 6His tag at the C-terminus.
Description: Cystatin-8 is a secreted protein which belongs to the cystatin family. The cystatin superfamily contains multiple cystatin-like sequences. Cystatin-8 localizes to the cystatin locus and encodes a protein similar to type 2 cystatins. Cystatin-8 performs a specialized role during sperm development and maturation. Cystatin-8 exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. In addition, Cystatin-8 performs a specialized role during sperm development and maturation.
Source: HEK293
Species: Human
Tag: His
AA Sequence: KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLI DVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDAVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ]
Official Symbol: CST8
Synonyms: CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein;
Gene ID: 10047
mRNA Refseq: NM_005492
Protein Refseq: NP_005483
MIM: 608683
UniProt ID: O60676
Chromosome Location: 20p11.21
Function: cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.