Recombinant Human CST8 Protein, GST-tagged

Cat.No. : CST8-2033H
Product Overview : Human CST8 full-length ORF ( AAH69536.1, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The encoded protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Molecular Mass : 36.8 kDa
AA Sequence : MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ]
Official Symbol CST8
Synonyms CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein;
Gene ID 10047
mRNA Refseq NM_005492
Protein Refseq NP_005483
MIM 608683
UniProt ID O60676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST8 Products

Required fields are marked with *

My Review for All CST8 Products

Required fields are marked with *

0
cart-icon
0
compare icon