Recombinant Human HLA-DRB5, His-tagged HLA-DRB5-104H

Recombinant Human HLA-DRB5, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human HLA-DRB5, His-tagged

Recombinant Human HLA-DRB5, His-tagged

HLA-DRB5 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HLA-DRB5-104H
Product Overview : Recombinant Human HLA Class II Histocompatibility Antigen DR β 5 Chain/HLA-DRB5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly30-Lys227) of Human HLA-DRB5 fused with a polyhistidine tag at the C-terminus.
Description : HLA Class II Histocompatibility Antigen DR β 5 Chain (HLA-DRB5) is a single-pass type I membrane protein that belongs to the MHC class II family. HLA-DRB5 contains one Ig-like C1-type domain. The class II molecule is a heterodimer consisting of an α (DRA) and a β chain (DRB), both anchored in the membrane. HLA-DRB5 plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. Within the DR molecule, the β chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. The presence of DRB5 is linked with allelic variants of DRB1, otherwise it is omitted.
Source : HEK293
Species : Human
Tag : His
AA Sequence : GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQK DFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVR WFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESA QSKVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : HLA-DRB5 major histocompatibility complex, class II, DR beta 5 [ Homo sapiens ]
Official Symbol : HLA-DRB5
Synonyms : HLA-DRB5; major histocompatibility complex, class II, DR beta 5; HLA-DRB;
Gene ID : 731247
Pathway : Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream TCR signaling, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy