"HSD17B13" Related Products

Expand

Recombinant Human HSD17B13, His-tagged

Cat.No.: HSD17B13-108H
Product Overview: Recombinant Human 17-β-Hydroxysteroid Dehydrogenase 13/HSD17B13 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu20-Lys300) of Human HSD17B13 fused with a 6His tag at the C-terminus.
Description: 17-β-Hydroxysteroid Dehydrogenase 13 (HSD17B13) is a secreted protein that belongs to the short-chain dehydrogenases/reductases (SDR) family. HSD17B13 is highly expressed in the liver, but it can also be detected in the ovary, bone marrow, kidney, brain, lung, skeletal muscle, bladder, and testis. HSD17B13 contains an ORF with a length of 900 bp, encoding a protein with a signal peptide sequence and an adh_short domain.
Source: HEK293
Species: Human
Tag: His
AA Sequence: ESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINKRGVEETAAECRKLG VTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHF WITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTS CLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASA ILNRMQNIQFEAVVGHKIKMKVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.