Recombinant Human HSD17B13, His-tagged
| Cat.No. : | HSD17B13-108H |
| Product Overview : | Recombinant Human 17-β-Hydroxysteroid Dehydrogenase 13/HSD17B13 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu20-Lys300) of Human HSD17B13 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 20-300 a.a. |
| Description : | 17-β-Hydroxysteroid Dehydrogenase 13 (HSD17B13) is a secreted protein that belongs to the short-chain dehydrogenases/reductases (SDR) family. HSD17B13 is highly expressed in the liver, but it can also be detected in the ovary, bone marrow, kidney, brain, lung, skeletal muscle, bladder, and testis. HSD17B13 contains an ORF with a length of 900 bp, encoding a protein with a signal peptide sequence and an adh_short domain. |
| AA Sequence : | ESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINKRGVEETAAECRKLG VTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHF WITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTS CLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASA ILNRMQNIQFEAVVGHKIKMKVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| ◆ Recombinant Proteins | ||
| HSD17B13-11H | Recombinant Human HSD17B13 protein(20-300aa) | +Inquiry |
| HSD17B13-2785M | Recombinant Mouse HSD17B13 Protein (20-304 aa), His-Myc-tagged | +Inquiry |
| HSD17B13-108H | Recombinant Human HSD17B13, His-tagged | +Inquiry |
| HSD17B13-4841HFL | Recombinant Full Length Human HSD17B13, Flag-tagged | +Inquiry |
| HSD17B13-338HCL | Recombinant Human HSD17B13 Over-ex<x>pression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B13 Products
Required fields are marked with *
My Review for All HSD17B13 Products
Required fields are marked with *
