Recombinant Human KLK2, His-tagged KLK2-122H

Recombinant Human KLK2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human KLK2, His-tagged

Recombinant Human KLK2, His-tagged

KLK2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : KLK2-122H
Product Overview : Recombinant Human Kallikrein 2/KLK2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro19-Pro261) of Human KLK2 fused with a polyhistidine tag at the C-terminus.
Description : Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.
Source : HEK293
Species : Human
Tag : His
Form : Supplied as a 0.2 μM filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5
AA Sequence : PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEP EDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPAL GTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDS GGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name : KLK2 kallikrein-related peptidase 2 [ Homo sapiens ]
Official Symbol : KLK2
Synonyms : KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201;
Gene ID : 3817
mRNA Refseq : NM_001002231
Protein Refseq : NP_001002231
MIM : 147960
UniProt ID : P20151
Chromosome Location : 19q13.33
Pathway : Activation of Matrix Metalloproteinases, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Extracellular matrix organization, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem;
Function : peptidase activity; serine-type endopeptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy