"KLK2" Related Products

Expand

Recombinant Human KLK2, His-tagged

Cat.No.: KLK2-122H
Product Overview: Recombinant Human Kallikrein 2/KLK2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro19-Pro261) of Human KLK2 fused with a polyhistidine tag at the C-terminus.
Description: Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.
Source: HEK293
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5
AA Sequence: PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEP EDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPAL GTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDS GGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.
Gene Name: KLK2 kallikrein-related peptidase 2 [ Homo sapiens ]
Official Symbol: KLK2
Synonyms: KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201;
Gene ID: 3817
mRNA Refseq: NM_001002231
Protein Refseq: NP_001002231
MIM: 147960
UniProt ID: P20151
Chromosome Location: 19q13.33
Pathway: Activation of Matrix Metalloproteinases, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Extracellular matrix organization, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.