"CSN3" Related Products

Expand
Expand
Expand

Recombinant Human CSN3, His-tagged

Cat.No.: CSN3-123H
Product Overview: Recombinant Human κ-Casein/CSN3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ala182) of Human CSN3 fused with a 6His tag at the C-terminus.
Description: Kappa-Casein (CSN3) is a secreted protein that belongs to the Kappa-Casein family. CSN3 exists in heteromultimers that are composed of alpha-s 1casein and kappa casein linked by disulfide bonds. CSN3 is involved in a number of important physiological processes. In the gut, CSN3 protein is split into an insoluble peptide (para kappa-casein) and a soluble hydrophilic glycopeptide (caseinomacropeptide). Caseinomacropeptide is responsible for increased efficiency of digestion, prevention of neonate hypersensitivity to ingested proteins, and inhibition of gastric pathogens. Kappa-casein also stabilizes micelle formation, preventing casein precipitation in milk.
Source: HEK293
Species: Human
Tag: His
AA Sequence: EVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPCVPRTYYANPA VVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEP TVDSVVTPEAFSESIITSTPETTTVAVTPPTAVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: CSN3 casein kappa [ Homo sapiens ]
Official Symbol: CSN3
Synonyms: CSN3; casein kappa; casein, kappa , CSN10; kappa-casein; KCA; CSNK; CSN10;
Gene ID: 1448
mRNA Refseq: NM_005212
Protein Refseq: NP_005203
MIM: 601695
UniProt ID: P07498
Chromosome Location: 4q21.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.