"LYZL1" Related Products

Recombinant Human LYZL1, His-tagged

Cat.No.: LYZL1-133H
Product Overview: Recombinant Human Lysozyme-Like Protein 1/LYZL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys20-Ser148) of Human LYZL1 fused with a polyhistidine tag at the C-terminus.
Description: Lysozyme-Like Protein 1 (LYZL1) is a member of the glycosyl hydrolase 22 family. Lysozymes are a family of enzymes that damage bacterial cell walls by catalyzing hydrolysis of 1,4-β-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence and structure making them part of the same family. LYZL1 is a secreted protein and exists as a monomer.
Source: HEK293
Species: Human
Tag: His
AA Sequence: KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCR RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVSV DHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: LYZL1 lysozyme-like 1 [ Homo sapiens ]
Official Symbol: LYZL1
Synonyms: LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1;
Gene ID: 84569
mRNA Refseq: NM_032517
Protein Refseq: NP_115906
UniProt ID: Q6UWQ5
Chromosome Location: 10p12.1
Function: hydrolase activity, acting on glycosyl bonds; lysozyme activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.