Recombinant Full Length Human LYZL1 Protein, GST-tagged
| Cat.No. : | LYZL1-6039HF |
| Product Overview : | Human LYZL1 full-length ORF ( AAH21730.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 194 amino acids |
| Description : | LYZL1 (Lysozyme Like 1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYZL2. |
| Molecular Mass : | 48 kDa |
| AA Sequence : | MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYZL1 lysozyme-like 1 [ Homo sapiens ] |
| Official Symbol | LYZL1 |
| Synonyms | LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1; |
| Gene ID | 84569 |
| mRNA Refseq | NM_032517 |
| Protein Refseq | NP_115906 |
| UniProt ID | Q6UWQ5 |
| ◆ Recombinant Proteins | ||
| LYZL1-6039HF | Recombinant Full Length Human LYZL1 Protein, GST-tagged | +Inquiry |
| LYZL1-133H | Recombinant Human LYZL1, His-tagged | +Inquiry |
| LYZL1-4531H | Recombinant Human LYZL1 Protein, GST-tagged | +Inquiry |
| LYZL1-9412M | Recombinant Mouse LYZL1 Protein | +Inquiry |
| LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL1 Products
Required fields are marked with *
My Review for All LYZL1 Products
Required fields are marked with *




