Recombinant Full Length Human LYZL1 Protein, GST-tagged
Cat.No. : | LYZL1-6039HF |
Product Overview : | Human LYZL1 full-length ORF ( AAH21730.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | LYZL1 (Lysozyme Like 1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYZL2. |
Molecular Mass : | 48 kDa |
AA Sequence : | MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYZL1 lysozyme-like 1 [ Homo sapiens ] |
Official Symbol | LYZL1 |
Synonyms | LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1; |
Gene ID | 84569 |
mRNA Refseq | NM_032517 |
Protein Refseq | NP_115906 |
UniProt ID | Q6UWQ5 |
◆ Recombinant Proteins | ||
LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL1-4531H | Recombinant Human LYZL1 Protein, GST-tagged | +Inquiry |
LYZL1-6039HF | Recombinant Full Length Human LYZL1 Protein, GST-tagged | +Inquiry |
LYZL1-1042H | Recombinant Human LYZL1 Protein (1-194 aa), His-SUMO-tagged | +Inquiry |
LYZL1-9412M | Recombinant Mouse LYZL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYZL1 Products
Required fields are marked with *
My Review for All LYZL1 Products
Required fields are marked with *
0
Inquiry Basket