Recombinant Human LYZL1 Protein, GST-tagged

Cat.No. : LYZL1-4531H
Product Overview : Human LYZL1 full-length ORF ( AAH21730.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LYZL1 (Lysozyme Like 1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYZL2.
Molecular Mass : 48 kDa
AA Sequence : MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYZL1 lysozyme-like 1 [ Homo sapiens ]
Official Symbol LYZL1
Synonyms LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1;
Gene ID 84569
mRNA Refseq NM_032517
Protein Refseq NP_115906
UniProt ID Q6UWQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYZL1 Products

Required fields are marked with *

My Review for All LYZL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon