Recombinant Human LYZL1 Protein (1-194 aa), His-SUMO-tagged

• Cat.No.: LYZL1-1042H
• Product Overview: Recombinant Human LYZL1 Protein (1-194 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-194 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 37.6 kDa
• AA Sequence: MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: LYZL1 lysozyme-like 1 [ Homo sapiens ]
• Official Symbol: LYZL1
• Synonyms: LYZL1; lysozyme-like 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1
• Gene ID: 84569
• mRNA Refseq: NM_032517
• Protein Refseq: NP_115906
• UniProt ID: Q6UWQ5