Recombinant Human LYZL1 Protein (1-194 aa), His-SUMO-tagged
Cat.No. : | LYZL1-1042H |
Product Overview : | Recombinant Human LYZL1 Protein (1-194 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-194 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 37.6 kDa |
AA Sequence : | MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LYZL1 lysozyme-like 1 [ Homo sapiens ] |
Official Symbol | LYZL1 |
Synonyms | LYZL1; lysozyme-like 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1; |
Gene ID | 84569 |
mRNA Refseq | NM_032517 |
Protein Refseq | NP_115906 |
UniProt ID | Q6UWQ5 |
◆ Recombinant Proteins | ||
LYZL1-4531H | Recombinant Human LYZL1 Protein, GST-tagged | +Inquiry |
LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL1-9412M | Recombinant Mouse LYZL1 Protein | +Inquiry |
LYZL1-1042H | Recombinant Human LYZL1 Protein (1-194 aa), His-SUMO-tagged | +Inquiry |
LYZL1-133H | Recombinant Human LYZL1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYZL1 Products
Required fields are marked with *
My Review for All LYZL1 Products
Required fields are marked with *
0
Inquiry Basket