"MBTPS1" Related Products

Expand

Recombinant Human MBTPS1, His-tagged

Cat.No.: MBTPS1-138H
Product Overview: Recombinant Human Membrane-Bound Transcription Factor Site-1 Protease/MBTPS1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys18-Val998) of Human MBTPS1 fused with a polyhistidine tag at the C-terminus.
Description: Membrane-Bound Transcription Factor Site-1 Protease (MBTPS1) is a member of the peptidase S8 family. MBTPS1 cleaves the endoplasmic reticulum loop of sterol regulatory element binding protein (SREBP) transcription factors. MBTPS1 catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins, but not by nickel or cobalt. MBTPS1 is inhibited by divalent copper and zinc ions and by its prosegment. MBTPS1 has a central role in the regulation of lipid metabolism in cells.
Source: HEK293
Species: Human
Tag: His
AA Sequence: RAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDG LGHG TFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNL SIGGPDFM DHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDN IARFSSRGMTTW ELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVVAGAVTL LVSTVQKRELVNPASM KQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSP SYIDLTECPYMWPYCSQPIY YGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIE VAFSYSSVLWPWSGYLAISISVTK KAASWEGIAQGHVMITVASPAETESKNGAEQTSTVK LPIKVKIIPTPPRSKRVLWDQYHNLRYP PGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQ HLRSMGYFVEVLGAPFTCFDASQYGTLLMVDS EEEYFPEEIAKLRRDVDNGLSLVIFSDW YNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELL SVWNMGFSDGLYEGEFTLANHDMY YASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVP ILGLYQIPAEGGGRIVLYGD SNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPS GAGSVTPERMEGNHLH RYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLS IDLDKVVLPNFR SNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ]
Official Symbol: MBTPS1
Synonyms: MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712;
Gene ID: 8720
mRNA Refseq: NM_003791
Protein Refseq: NP_003782
MIM: 603355
UniProt ID: Q14703
Chromosome Location: 16q24
Pathway: Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.