"MRPS7" Related Products

Expand

Recombinant Human MRPS7, His-tagged

Cat.No.: MRPS7-148H
Product Overview: Recombinant Human 28S Ribosomal Protein S7 Mitochondrial/MRPS7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser38-Trp242) of Human MRPS7 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: SPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGG NKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRF YQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEA NRALAHYRWWVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens ]
Official Symbol: MRPS7
Synonyms: MRPS7; mitochondrial ribosomal protein S7; RP-S7; RPMS7; MRP-S7;
Gene ID: 64967

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.