"MMRN1" Related Products

Expand

Recombinant Human MMRN1, His-tagged

Cat.No.: MMRN1-150H
Product Overview: Recombinant Human Multimerin-1/MMRN1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu20-Thr1228) of Human MMRN1 fused with a polyhistidine tag at the C-terminus.
Description: Multimerin-1 (MMRN1) is a massive soluble protein found in platelets and in the endothelium of blood vessels. It contains one C1q domain, one EGF-like domain, and one EMI domain. MMRN1 is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. MMRN1 is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. Upon release following platelet activation, may limit platelet and plasma factor Va-dependent thrombin generation. MMRN1may also have functions as an extracellular matrix or adhesive protein.
Source: HEK293
Species: Human
Tag: His
AA Sequence: LNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIATTPEARTSEDSLLKSTLP PSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTNASIKFNPGAESVVLSNSTLKFLQSFARKS NEQATSLNTVGGTGGIGGVGGTGGVGNRAPRETYLSRGDSSSSQRTDYQKSNFETTRGKNWCAYV HTRLSPTVILDNQVTYVPGGKGPCGWTGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPK CQLRAQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDN ISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQL FKTVSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTC EKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVS NNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFK FQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPK EAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTI INNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLNDSIQTLVNDNQRYNFV LQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQNMSHLEEKLLLTTKISKNFETRLQD IESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKSIHLSINFFSLNKTLHEVLT MCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLREFVEPIIQIKTQAALSNLTCCIDRSLPGSL ANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYPEEYSSCSRHPCQNGGTCING RTSFTCACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFNNLDV NYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTG DALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRTVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MMRN1 multimerin 1 [ Homo sapiens ]
Official Symbol: MMRN1
Synonyms: MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN;
Gene ID: 22915
mRNA Refseq: NM_007351
Protein Refseq: NP_031377
MIM: 601456
UniProt ID: Q13201
Chromosome Location: 4q22
Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.