Recombinant Human NPTN, His-tagged

• Cat.No.: NPTN-159H
• Product Overview: Recombinant Human Neuroplastin is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln29-His220) of Human NPTN fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 29-220 a.a.
• Description: Neuroplastin is a 52-57 kDa member of the Ig-superfamily. Neuroplastin likely serves as a cell adhesion molecule, and is widely expressed in multiple tissues. Human Neuroplastin is 282 amino acids in length. Human Neuroplastin is a type I transmembrane glycoprotein that contions two Ig-like domains (aa 32-119 and 122-213) and a 38 aa cytoplasmic region (aa 245-282).
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPR AEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKK ENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDH HHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: NPTN neuroplastin [ Homo sapiens ]
• Official Symbol: NPTN
• Synonyms: NPTN; neuroplastin; SDFR1, stromal cell derived factor receptor 1; GP55; GP65; np55; np65; SDR1; SDR-1; stromal cell-derived receptor 1; stromal cell derived factor receptor 1; SDFR1; MGC102805; DKFZp686L2477
• Gene ID: 27020
• mRNA Refseq: NM_001161363
• Protein Refseq: NP_001154835
• MIM: 612820
• UniProt ID: Q9Y639
• Chromosome Location: 15q24.1
• Function: cell adhesion molecule binding; type 1 fibroblast growth factor receptor binding