Recombinant Human NPTN, His-tagged

Cat.No. : NPTN-159H
Product Overview : Recombinant Human Neuroplastin is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln29-His220) of Human NPTN fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 29-220 a.a.
Description : Neuroplastin is a 52-57 kDa member of the Ig-superfamily. Neuroplastin likely serves as a cell adhesion molecule, and is widely expressed in multiple tissues. Human Neuroplastin is 282 amino acids in length. Human Neuroplastin is a type I transmembrane glycoprotein that contions two Ig-like domains (aa 32-119 and 122-213) and a 38 aa cytoplasmic region (aa 245-282).
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPR AEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKK ENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDH HHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name NPTN neuroplastin [ Homo sapiens ]
Official Symbol NPTN
Synonyms NPTN; neuroplastin; SDFR1, stromal cell derived factor receptor 1; GP55; GP65; np55; np65; SDR1; SDR-1; stromal cell-derived receptor 1; stromal cell derived factor receptor 1; SDFR1; MGC102805; DKFZp686L2477;
Gene ID 27020
mRNA Refseq NM_001161363
Protein Refseq NP_001154835
MIM 612820
UniProt ID Q9Y639
Chromosome Location 15q24.1
Function cell adhesion molecule binding; type 1 fibroblast growth factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPTN Products

Required fields are marked with *

My Review for All NPTN Products

Required fields are marked with *

0
cart-icon