Recombinant Human NPTN, His-tagged
Cat.No. : | NPTN-159H |
Product Overview : | Recombinant Human Neuroplastin is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln29-His220) of Human NPTN fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 29-220 a.a. |
Description : | Neuroplastin is a 52-57 kDa member of the Ig-superfamily. Neuroplastin likely serves as a cell adhesion molecule, and is widely expressed in multiple tissues. Human Neuroplastin is 282 amino acids in length. Human Neuroplastin is a type I transmembrane glycoprotein that contions two Ig-like domains (aa 32-119 and 122-213) and a 38 aa cytoplasmic region (aa 245-282). |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPR AEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKK ENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDH HHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | NPTN neuroplastin [ Homo sapiens ] |
Official Symbol | NPTN |
Synonyms | NPTN; neuroplastin; SDFR1, stromal cell derived factor receptor 1; GP55; GP65; np55; np65; SDR1; SDR-1; stromal cell-derived receptor 1; stromal cell derived factor receptor 1; SDFR1; MGC102805; DKFZp686L2477; |
Gene ID | 27020 |
mRNA Refseq | NM_001161363 |
Protein Refseq | NP_001154835 |
MIM | 612820 |
UniProt ID | Q9Y639 |
Chromosome Location | 15q24.1 |
Function | cell adhesion molecule binding; type 1 fibroblast growth factor receptor binding; |
◆ Recombinant Proteins | ||
RFL3202MF | Recombinant Full Length Mouse Neuroplastin(Nptn) Protein, His-Tagged | +Inquiry |
NPTN-2902R | Recombinant Rhesus Macaque NPTN Protein, His (Fc)-Avi-tagged | +Inquiry |
Nptn-4479M | Recombinant Mouse Nptn Protein, Myc/DDK-tagged | +Inquiry |
NPTN-6175M | Recombinant Mouse NPTN Protein, His (Fc)-Avi-tagged | +Inquiry |
NPTN-3712R | Recombinant Rat NPTN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPTN-3727HCL | Recombinant Human NPTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPTN Products
Required fields are marked with *
My Review for All NPTN Products
Required fields are marked with *