"OTX2" Related Products

Recombinant Human OTX2

Cat.No.: OTX2-165H
Product Overview: Recombinant Human Homeobox Protein OTX2 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu297) of Human OTX2.
Description: Homeobox Protein OTX2 is a number of the paired homeobox family of the Bicoid subfamily. OTX2 contains 1 homeobox DNA-binding domain and expresses in brain. OTX2 may play a role in the development of the brain and the sense organs. OTX2 positively regulate of gastrulation and embryonic development. Defects in OTX2 are the cause of microphthalmia syndromic type 5, which is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. It also causes pituitary hormone deficiency combined type 6. Combined pituitary hormone deficiency is defined as the impaired production of growth hormone and one or more of the other five anterior pituitary hormones.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALF AKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVS SESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQ GYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNS TTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVLLEHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: OTX2 orthodenticle homeobox 2 [ Homo sapiens ]
Official Symbol: OTX2
Synonyms: OTX2; orthodenticle homeobox 2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; orthodenticle homolog 2; CPHD6; MCOPS5; MGC45000;
Gene ID: 5015
mRNA Refseq: NM_021728
Protein Refseq: NP_068374
MIM: 600037
UniProt ID: P32243
Chromosome Location: 14q22.3
Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; eukaryotic initiation factor 4E binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.