"PACSIN1" Related Products

Expand

Recombinant Human PACSIN1, His-tagged

Cat.No.: PACSIN1-166H
Product Overview: Recombinant Human Protein Kinase C and Casein Kinase Substrate in Neurons Protein 1/PACSIN1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ile444) of Human PACSIN1 fused with a 6His tag at the C-terminus.
Description: Protein Kinase C and Casein Kinase Substrate in Neurons Protein 1 (PACSIN1) belongs to the PACSIN family. PACSIN1 contains one FCH domain and one SH3 domain. PACSIN1 is highly expressed in the brain and at lower leves in the heart, pancreas, and liver. PACSIN1 may play a role in vesicle formation and transport. PACSIN1 has been shown to interact with DNM1, PACSIN3, Huntingtin, and PACSIN2. In addition, PACSIN1 is phosphorylated by casein kinase 2 (CK2) and protein kinase C (PKC).
Source: HEK293
Species: Human
Tag: His
AA Sequence: MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAK RWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFK ETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKV DKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAE NSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEG VALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRV RALYDYDGQEQDELSFKAGDELTKLGEEDE QGWCRGRLDSGQLGLYPANYVEAIVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: PACSIN1 protein kinase C and casein kinase substrate in neurons 1 [ Homo sapiens ]
Official Symbol: PACSIN1
Synonyms: PACSIN1; protein kinase C and casein kinase substrate in neurons 1; protein kinase C and casein kinase substrate in neurons protein 1; SDPI; syndapin I; KIAA1379;
Gene ID: 29993
mRNA Refseq: NM_001199583
Protein Refseq: NP_001186512
MIM: 606512
UniProt ID: Q9BY11
Chromosome Location: 6p21.3
Function: cytoskeletal protein binding; protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.