"GNRH2" Related Products

Expand

Recombinant Human GNRH2, His-tagged

Cat.No.: GNRH2-178H
Product Overview: Recombinant Human Progonadoliberin-2/GNRH2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Val120) of Human GNRH2 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTT AQWSLHRKRHLARTLLTAAREPRPAPPSSNKVVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: GNRH2 gonadotropin-releasing hormone 2 [ Homo sapiens ]
Official Symbol: GNRH2
Synonyms: GNRH2; gonadotropin-releasing hormone 2; progonadoliberin-2; luliberin II; progonadoliberin II; luteinizing hormone-releasing hormone II; GnRH-II; LH-RHII;
Gene ID: 2797
mRNA Refseq: NM_001501
Protein Refseq: NP_001492
MIM: 602352
UniProt ID: O43555
Chromosome Location: 20p13
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Hormone ligand-binding receptors, organism-specific biosystem;
Function: hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.