"SIAE" Related Products

Expand
Expand

Recombinant Human SIAE, His-tagged

Cat.No.: SIAE-189H
Product Overview: Recombinant Human Sialate O-Acetylesterase/SIAE is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile24-Lys523) of Human SIAE fused with a 6His tag at the C-terminus.
Description: Sialate O-Acetylesterase (SIAE) belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. SIAE is widely expressed with high expression levels in the testis, prostate, and colon. SIAE catalyzes N-acetyl-O-acetylneuraminate and H2O to N-acetylneuraminate and acetate. SIAE removes O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. SIAE down-regulates B lymphocyte antigen receptor signaling (involving CD22), and is required for immunological tolerance. Loss of function mutations in SIAE are much more frequently found in humans with autoimmune diseases especially rheumatoid arthritis and type 1 diabetes.
Source: HEK293
Species: Human
Tag: His
AA Sequence: IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDP MKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVR ILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSW GGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNIN YNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFG YVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIE LLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVAL RYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAKVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: SIAE sialic acid acetylesterase [ Homo sapiens ]
Official Symbol: SIAE
Synonyms: SIAE; sialic acid acetylesterase; YSG2, Ysg2 homolog (mouse); sialate O-acetylesterase; CSE C; LSE; MGC87009; sialic acid specific acetylesterase II; H-Lse; sialic acid-specific acetylesterase II; cytosolic sialic acid 9-O-acetylesterase homolog; AIS6; CSEC; YSG2; CSE-C;
Gene ID: 54414
mRNA Refseq: NM_001199922
Protein Refseq: NP_001186851
MIM: 610079
UniProt ID: Q9HAT2
Chromosome Location: 11q24
Function: carboxylesterase activity; hydrolase activity; sialate O-acetylesterase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.